PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA54G00120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 347aa    MW: 39358.7 Da    PI: 5.3108
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA54G00120genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W++ ++  g++R++k+c++rw +yl
       AA54G00120 14 KGPWTPEEDQKLIDYIHNHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.26.7e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
       AA54G00120  67 RGKFSAEEEQTILHLHSILGNK-WSAIATHLQ-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.325961IPR017930Myb domain
SuperFamilySSF466899.36E-3111108IPR009057Homeodomain-like
SMARTSM007171.8E-151363IPR001005SANT/Myb domain
PfamPF002493.6E-181461IPR001005SANT/Myb domain
CDDcd001671.57E-111661No hitNo description
PROSITE profilePS5129426.6662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2765117IPR009057Homeodomain-like
SMARTSM007177.8E-1666114IPR001005SANT/Myb domain
PfamPF002497.5E-1667112IPR001005SANT/Myb domain
CDDcd001676.22E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLIDYIH NHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LKPDIKRGKF SAEEEQTILH LHSILGNKWS AIATHLQGRT DNEIKNFWNT HLKKKLIQMG  120
IDPVTHQPRT DLFASLPQLI ALANLKDLLE QTSQYSSIQA EAAQLAKLQY LQCMLNSSVS  180
SSTNTHDSPT SILDIDQNHA MNLLNSMVSW NKDQVLEDQN QRLLFQEETI TNLTTQPLQQ  240
EQYNIDNNSM EITLQNDPFL DHVPFNLQTP LNSDQEHFVD HLVKHQDNEN DTSSWALLPS  300
LDDHNVNNTT SLSHSNPSSS SSYGGDGGSL YNWPDFCFDE SLINDIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306516.10.0hypothetical protein CARUB_v10012515mg
TrEMBLR0IAG50.0R0IAG5_9BRAS; Uncharacterized protein
STRINGAT1G34670.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-174myb domain protein 93